X-Authentication-Warning:	delorie.com: mail set sender to geda-user-bounces using -f
X-Recipient:	geda-user AT delorie DOT com
X-Original-DKIM-Signature:	v=1; a=rsa-sha1; d=ptd.net; s=mail; c=relaxed/simple;
	q=dns/txt; i=@ptd.net; t=1625667279;
	h=From:Subject:Date:To:MIME-Version:Content-Type;
	bh=xTE19M78/osBsZua7S9hFWZDhx0=;
	b=BqIncyeSQT32qaCH9VPkpF8e1gjdNfutqCphBjMOjPQ6wH+Z7pqt8WkTHqr9bUW9
	2Y5U5KYAzV/OKfefoT6hX+yY96rTrF2IjLyjZ8le/Lc6oG7P5TuwwS9Zmr4Uzsp6
	pHmaP6aJGqdBSaQ1OfFsWOSq4f1QnZi2hNCEeFv0nld9j0aeasvITZBndCwrgHv1
	CTrFA91CcqgTEGdL/HfnLnQqRY5DvUl3NH5at42wugJ9eGYDitK6U67X7N2aQ5JV
	yy9FQ5vHpkZ1hywI1wE895LwyG7a7tJRC7LXTXlPGVgaWWbbLwm8JQgYoWkbI6AQ
	pR44EALW0EsuW0aKRfFDoQ==;
X-Authed-Username:	bWVuYXNpYW5AcHRkLm5ldA==
Authentication-Results:	smtp02.ptd.email-ash1.sync.lan smtp.user=<hidden>; auth=pass (LOGIN)
Date:	Wed, 7 Jul 2021 10:14:37 -0400
From:	"Stephen C. Menasian (menasian AT ptd DOT net) [via geda-user AT delorie DOT com]" <geda-user AT delorie DOT com>
To:	geda-user AT delorie DOT com
Subject:	[geda-user] Thank you - some requests and an offer
Message-ID:	<20210707101437.2c7c63a6@queeg>
X-Mailer:	Claws Mail 3.17.8 (GTK+ 2.24.33; x86_64-redhat-linux-gnu)
MIME-Version:	1.0
X-Vade-Verdict:	clean
X-Vade-Analysis-1:	gggruggvucftvghtrhhoucdtuddrgedvtddrtddvgdejvdcutefuodetggdotefrodftvfcurfhrohhf
X-Vade-Analysis-2:	ihhlvgemucfujgfpteevqfftpdfrvfffpdfqfgfvnecuuegrihhlohhuthemuceftddunecunecujfgu
X-Vade-Analysis-3:	rhepfffhvffukffogggtgfesthejredtredtvdenucfhrhhomhepfdfuthgvphhhvghnucevrdcuofgv
X-Vade-Analysis-4:	nhgrshhirghnfdcuoehmvghnrghsihgrnhesphhtugdrnhgvtheqnecuggftrfgrthhtvghrnhephfeg
X-Vade-Analysis-5:	gfdtvdeljeehtefhheevteefheektdfhudethedvteetjeeutdelffetteeunecukfhppeejtddrgeeg
X-Vade-Analysis-6:	rddukeejrdekfeenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhepihhnvghtpeejtddrgeeg
X-Vade-Analysis-7:	rddukeejrdekfedphhgvlhhopehquhgvvghgpdhmrghilhhfrhhomhepmhgvnhgrshhirghnsehpthgu
X-Vade-Analysis-8:	rdhnvghtpdhrtghpthhtohepshgtmhesmhgvnhgrshhirghnshdrtghomhdprhgtphhtthhopehgvggu
X-Vade-Analysis-9:	rgdquhhsvghrseguvghlohhrihgvrdgtohhmpdhhohhsthepshhmthhprdhpthgurdgvmhgrihhlqdgr
X-Vade-Analysis-10:	shhhuddrshihnhgtrdhlrghnpdhsphhfpehfrghilhdpughkihhmpedpnhgspghrtghpthhtohepvddp
X-Vade-Analysis-11:	tehuthhhqdgfshgvrhepmhgvnhgrshhirghnsehpthgurdhnvght
X-Vade-Client:	PTD
Reply-To:	geda-user AT delorie DOT com

Thank you very much for reviving the gEDA project. gschem has been my
schematic capture program of choice since it was in the beta stage. When
support seemed to have vanished a while ago, I continued to use my old
(locally compiled) version. The substitute offered by Fedora (Kicad, I
think) was not to my liking and there seemed to be no tools to port all
my gschem schematic and symbol files to the Kicad platform. When I found
that gschem support was revived, I was overjoyed.

Now to my requests. I apologize if these requests are already somewhere
in the mailing list; I haven't gone through all the past postings. 

1) The old gschem had an option in the print dialog to print the visible
region of the schematic. I used this frequently for several reasons - for
example, to have an uncluttered large scale print of a part of the
schematic while developing a circuit. This option is missing in the
present release; it would be nice to have it back. My current workaround
is cumbersome. I export to pdf with the highest possible resolution, open
the pdf in GIMP, crop and scale it and print the result.

2) The old gschem behaved thusly when a part (or portion of a circuit)
was selected and copied (at least the way I had set up my gschemrc):
The selection remained with the originally selected part(s) after the
copy and the new copy was not selected. The new gschem transfers the
selection to the copy when it is placed. It would be nice to have a
gschemrc option to allow the selection to remain with the original part.

Finally, an offer. I have written a C program which I call "geda_parts".
It reads a .sch file and creates an almost publishable parts list. For
example: "geda_parts xxyy.sch R" would produce a file "xxyy_R.parts"
which lists all the resistors in numerical order. This file is also useful
for finding duplicated reference designators and holes in the reference
designator sequence. It currently works for most of the common part types
(resistors, capacitors, transistors, ICs, inductors, etc,). I have yet to
make some modifications to handle multislot ICs and will probably do some
more cleaning up but, if there is any interest, I can post the source
once it is stable. 

- Raw text -